Python is a small, self-consistent general-purpose programming language.
Tools
Gooey
Turn a Python CLI into a GUI with one line
MyPyVy
symbolic transitions in python
Rich
Print rich terminal text
pycopy
python dialect for microcontrollers
httpie
modern, friendly http client
forbidden fruit
allow python to extend built in types
hy
a lisp embedded in python
https://m.youtube.com/watch?v=u2KZJzoz-qI https://github.com/evhub/coconut https://github.com/pyca/bcrypt Cybersecurity https://github.com/mkilgore/protura https://github.com/jspahrsummers/adt https://github.com/skulpt/skulpt JavaScript implementation of python https://github.com/nmigen/nmigen python toolkit for hardware https://github.com/leoneckert/masks-and-hats apply masks and hats to faces Machine Learning generate python cli from any python object make python programs functional and type safe! linux distribution with a python userspace,Operating Systems python sequence diagrams rocky/python-uncompyle6: A cross-version Python bytecode decompilerCybersecurity odashi/latexifypy: Generates LaTeX math description from Python functions. Super Advanced Python - YouTube construct/construct: Construct: Declarative data structures for python that
Table of Contents
-
[* testing](#tstng TIDDLYLINK) [[testing]]
[2020-03-27]Hypothesis has a set of Pandas strategies for generating data [[pandas]][2020-05-05]python - Run code before and after each test in py.test? - Stack Overflow[2019-08-02]python - How should I structure a pytest test only package? - Stack Overflow [[testing]] [[project]] [[pip]]- [[doctest?]]
- [[pytest can detect recursion]] [[pytest]]
- [* profiling](#prflng TIDDLYLINK) [[performance]]
-
[* packaging](#pckgng TIDDLYLINK) [[pip]]
[2020-04-02]minimal-setup-py/setup.py at master · maet3608/minimal-setup-py- [install only dependencies:
pip3 install --user -e .](#nstllnlydpndncsppnstllsr TIDDLYLINK) - [[install multiple packages at once]]
[2020-04-24]local PIP dependency: if the repo is in/path/to/repo, putHPI@git+file://DUMMY/path/to/repo@masterinsetup.py[[pip]][2019-12-15]bast/pypi-howto: How to publish Python packages on PyPI. [[pypi]]-
[2019-07-02]Testing & Packaging · Homepage of Hynek Schlawack - [[releasing on pypi]] [[pypi]]
- [* debugging](#dbggng TIDDLYLINK) [[debug]]
- [* bad things about python](#bdthngsbtpythn TIDDLYLINK)
- [* static analysers](#sttcnlysrs TIDDLYLINK)
- [* libraries](#lbrrs TIDDLYLINK)
- [* Import system](#mprtsystm TIDDLYLINK)
-
[* datetime handling](#dttmhndlng TIDDLYLINK) [[datetime]]
[2018-09-04]utcfromtimestamp – returns timestamp, unaware; fromtimestamp – returns offset + timestamp, unaware[2018-09-04]ok, seems that it's better to usepytz.utc.localize(tz_unaware_datetime)[2020-05-02]zachwill/moment: Dealing with dates in Python shouldn't have to suck.[2020-05-02]zachwill/moment: Dealing with dates in Python shouldn't have to suck.
- [* logging](#lggng TIDDLYLINK) [[logging]]
-
[* docs](#dcs TIDDLYLINK)
- [[pydoc]]
- [[ipython: ? and ??]]
- [* ipdb](#pdb TIDDLYLINK) [[ipdb]]
- [[----]]
[2019-09-22]Python3 f-strings - A complete guide to the most well received feature of Python 3. /r/Python-
[2019-05-11]To yield or not to yield [[yield]] - [AST
ast.dump(ast.parse("'a' in 'aa' in 'aaa'"))](#ststdmpstprsnn TIDDLYLINK) - [[use for – else]] [[habit]]
[2018-06-18]log optimizers i used[2018-06-11]optimizing python CLI tools https://files.bemusement.org/talks/OSDC2008-FastPython/- [parser.addargument('rest, nargs=argparse.REMAINDER)](#prsrddrgmntrstnrgsrgprsrmndr TIDDLYLINK) [[habit]]
-
[[awesome-python https://github.com/vinta/awesome-python]]
- [[should definitely subscribe to its feed and go through again]]
- [[https://github.com/vinta/awesome-python#command-line-tools]]
- [[pretty cool https://github.com/timofurrer/try]]
- [[cool https://github.com/dbcli/mycli]]
- [[hmm try that? http://docopt.org/]]
- [[some of these for nutrino? https://github.com/vinta/awesome-python#database]]
- [[hmm that's interesting, visual scraping https://github.com/scrapinghub/portia]]
- [[https://www.reddit.com/r/coolgithubprojects/]]
- [[?? https://python.libhunt.com/]]
- [[do not use replace tzinfo, always localize..]] [[habit]]
[2019-01-01]multiline string – lstrip('\n') for nicer formatting![2019-03-20]Tweet from Vladislav Isenbaev (@isenbaev), at Mar 20, 03:48: pickle просто скотски медленный, если что - кратно медленнее даже json'а[2019-08-11]multiprocessing vs multithreading vs asyncio in Python 3.4 - Stack Overflow [[concurrency]] [[performance]][2020-01-03]adamchainz/patchy: Patch the inner source of python functions at runtime. [[lisp]][2019-12-31]PyPy.js: Python in the web browser | Hacker News [[js]] [[webext]][2018-06-22]difflib.unified_diffis suuuuper slow…[2018-04-21]scrapy debugging [[scrapy]][2018-08-30]python's for..else makes in 'syntactially' look like a total function-
[[NamedTuple]]
- [use
typing.NamedTuple](#stypngnmdtpl TIDDLYLINK) - [watch out for default add and mul, it acts as adding pairs](#wtchtfrdfltddndmltctssddngprs TIDDLYLINK)
- [you can't easily overload init, so make types of fields robust. Use a helper method instead](#ycntslyvrldntsmktypsffldsrbstshlprmthdnstd TIDDLYLINK)
- [use
- [[Use contextmanager]]
[2018-12-08]get current function/method name- [[traitlets?]]
[2019-04-30]What's the difference between marshmallow and sql-alchemy? /r/flask[2019-06-29]dominatepp/.travis.yml at master · karlicoss/dominatepp [[ci]][2019-08-12]usere.VERBOSEfor inline comments in regexes[2019-10-21]python - What do (lambda) function closures capture? - Stack Overflow [[plt]][2019-12-30]argparse — Parser for command-line options, arguments and sub-commands — Python 3.8.1 documentation[2020-01-07]Performance — python-rapidjson 0.4 documentation [[json]][2019-07-19]python - Argparse: Way to include default values in '–help'? - Stack Overflow[2019-12-31]PyPy - packages http://packages.pypy.org [[pypy]]- [[Construct: kinda like struct but better? https://construct.readthedocs.io/en/latest/]] [[parsing]]
- [[Pyrser: grammars? https://pythonhosted.org/pyrser/]] [[parsing]]
[2019-07-21]kython@git+https://github.com/karlicoss/kython.git@master dependency for setup.cfg [[pip]][2018-07-22]PyCon 2018 Talk Videos : Python https://www.reddit.com/r/Python/comments/8j4ep6/pycon_2018_talk_videos/ [[towatch]][2019-08-02]Basic usage — tox 3.13.3.dev13 documentation[2018-06-12]if there is a 'main.py' in script dir, it gets imported – wtf????[2019-07-20]concurrent.futures https://docs.python.org/3.7/library/concurrent.futures.html?highlight=processpoolexecutor usemap[2019-08-11]PyCQA/pyflakes: A simple program which checks Python source files for errors[2019-08-02]posargs are needed to passing adhoc args, e.g. [[tox]][2018-04-17]some misc notes- [
from http import HTTPStatus](#frmmprtstts TIDDLYLINK) [2018-01-21]use nonlocal instead of global [[habit]]- [[!r formatter]] [[habit]]
[2019-04-22]yield is often preferrable because python doesn't have bindings in generators[2019-05-01]there is a difference between returning generator and yield from generator. the latter keeps scope, which might be useful if you have open files-
[2019-07-30]To yield or not to yield [[decorator]] - [[use putup (pyscaffold) for project generation]] [[habit]]
- [[Poetry instead of pyscaffold?]] [[python]]
-
[2019-08-25]https://docs.python.org/3.7/library/argparse.html argparse: useset_defaults - [generateordering?](#gnrtrdrng TIDDLYLINK) [[python]]
[2020-07-05]How can I color Python logging output? - Stack Overflow [[logging]] [[kython]][2020-02-16]Direct URL PEP 508 support and installing sub-dependencies from Git · Issue 5566 · pypa/pip [[pip]][2020-02-16]Allow direct urls in installrequires · Issue 6301 · pypa/pip [[python]]-
[2019-07-25]rstojnic/lazydata: Lazydata: Scalable data dependencies for Python projects - [[using pytest fixtures to inject stuff into the module]] [[python]] [[pytest]]
- [[end2end gui semi manual tests]] [[promnesia]] [[python]] [[testing]]
- [[pytest dependencies]] [[python]]
[2019-12-31]backoff · PyPI- [[Poetry for dep management]] [[python]]
[2019-12-15]Support automatic versioning setuptoolsscm-style? · Issue 140 · python-poetry/poetry- [it's clearly not detecting changes in
install_requires; needed to reinsall](#tsclrlyntdtctngchngsnnstllrqrsnddtrnsll TIDDLYLINK) [[tox]] [2019-07-26]python - pytest exits with no error but with "collected 0 items" - Stack Overflow [[pytest]][2019-10-26]traceback — Print or retrieve a stack traceback — Python 3.8.0 documentation [[errors]]- [[separate testing and linting since mypy's deps might be installed by accident?]] [[python]] [[tox]]
[2019-11-09]python - Run an OLS regression with Pandas Data Frame - Stack Overflow- [[figure out a better framework for python multiprocessing…]] [[python]]
[2019-09-01]vinta/awesome-python: A curated list of awesome Python frameworks, libraries, software and resources [[tui]]- [[sigh… don't think it's possible to properly preserve stacktraces…]] [[python]] [[errors]]
- [[strptime is incapable of handling timezones via %Z direcive??]] [[python]] [[timezone]]
[2020-03-12]encode/httpx: A next generation HTTP client for Python. 🦋[2020-09-02]Python Prompt Toolkit 3.0 — prompttoolkit 3.0.2 documentation [[tui]] [[python]][2020-09-18]testing - Python/tox Install a dependency as editable - Stack Overflow [[python]] [[tox]] [[pip]][2020-09-18]testing - Python/tox Install a dependency as editable - Stack Overflow [[hpi]][2020-09-27]python - What is the difference between venv, pyvenv, pyenv, virtualenv, virtualenvwrapper, pipenv, etc? - Stack Overflow- [[adapter thigs with getattr (like in workout provider for org notes) – pretty great for adding one missing method]] [[python]]
[2019-08-25]argparseweb · PyPI[2019-09-01]vinta/awesome-python: A curated list of awesome Python frameworks, libraries, software and resources [[cli]][2019-08-02]GrahamDumpleton/wrapt: A Python module for decorators, wrappers and monkey patching.- [[attemt to figure out mixed sem/cal versioning]] [[project]] [[pip]]
- [had to remore username from hatch config? it was overriding token during the release..](#hdtrmrsrnmfrmhtchcnfgtwsvrrdngtkndrngthrls TIDDLYLINK) [[pypi]]
-
[2020-03-31]why it is hard – if you have 2fa you can't upload packages [[pypi]] [2019-12-15]tox support python-poetry/poetry- [findpackages in setup.py?](#fndpckgsnstppy TIDDLYLINK) [[python]]
- [[eee]] [[ipython]]
[2019-09-01]KoffeinFlummi/Chronyk: A Python 3 library for parsing human-written times and dates[2019-11-17]sampleproject/setup.py at master · pypa/sampleproject- [[nicer attribute errors]] [[python]]
[2019-07-25]pytest-profiling · PyPI- [[Poetry easy pip publishing]]
- [[use quit instead of close?]] [[selenium]]
[2020-10-06]Brython [[python]] [[web]][2020-01-09]logzero: Python logging made easy — logzero 1.5.0 documentation- [[marshmallow for db handling looks interesting…]] [[python]]
- [[PandaPy]]
[2019-10-27]Ability to execute certain tests sequentially while using -n (xdist) · Issue #385 · pytest-dev/pytest-xdist[2019-10-27]pylint exceed maximum recursion depth · Issue #2388 · PyCQA/pylint[2019-10-27]Search pylint configuration in setup.cfg and pyproject.toml · Issue #617 · PyCQA/pylint[2019-11-08]How do I use regex in a SQLite query? - Stack Overflow [[sqlite]]- [[-pdbcls=IPython.terminal.debugger:TerminalPdb –pdb]] [[python]] [[ipython]] [[debug]]
- [[wonder how to make sure dataclasses are represented very effecienly?]] [[python]]
[2020-06-07]Types at the edges in Python – MeadSteve's Dev Blog [[python]]- [[figuring out why has the package ended up in path]] [[python]]
[2020-12-08]Exhaustiveness Checking with Mypy | Haki Benita [[python]] [[mypy]]- [[hvplot: clever algebra on plots]] [[bokeh]]
[2020-04-09]naiquevin/pipdeptree: A command line utility to display dependency tree of the installed Python packages [NOT ACCEPTING PRs FOR A WHILE BECAUSE OF MAJOR REFACTORING IN ANOTHER BRANCH]-
[2020-04-23]pandas/setup.py at master · pandas-dev/pandas [[pip]] [2019-07-28]kirankoduru/scrapy-programmatically: Running scrapy spider programmatically. [[scrape]][2020-04-23]detect all subpackages properly · karlicoss/promnesia@f7451c4[2020-04-05]Configs suck? Try a real programming language | Hacker News[2020-10-14]google/python-fire: Python Fire is a library for automatically generating command line interfaces (CLIs) from absolutely any Python object. [[cli]][2020-04-23]samuelhwilliams/Eel: A little Python library for making simple Electron-like HTML/JS GUI apps [[gui]][2020-04-15]setuptools/_init_.py at master · pypa/setuptools- [[keeping testss side by side with code]] [[pytest]]
[2020-04-30]pkgutil — Package extension utility — Python 3.8.3rc1 documentation[2020-03-24]PEP 593 – Flexible function and variable annotations | Python.org[2019-08-24]Simple dependent types in Python - DEV Community 👩💻👨💻 [[mypy]] [[python]][2020-07-08]SymPy - a Python library for symbolic mathematics | Hacker News [[sympy]] [[sage]][2020-07-26]The Qt Console for Jupyter — Jupyter Qt Console 4.7.5 documentation[2020-10-15]Frame Hacks [[python]][2019-03-17]pylint useful stuff [[python]]- [[try using devpi for uploading?]] [[tox]]
[2020-05-25]docopt v argparse • Dimitri Merejkowsky [[python]][2019-12-08]Dynamically change slots in Python 3 - Stack Overflow [[python]][2020-10-24]LiveCode is a modern day HyperCard (2019) | Hacker News [[python]] [[gui]][2020-01-15]Show HN: CrossHair – SMT Assisted Testing for Python [[testing]] [[python]]-
[2019-11-10]lihaoyi/macropy: Macros in Python: quasiquotes, case classes, LINQ and more! [[macro]] [[python]] [[lisp]] [2020-01-09]What does it do? — Logbook [[python]] [[logging]][2019-11-24]How formulas work — patsy 0.5.1+dev documentation[2019-12-20]Pipenv: promises a lot, delivers very little | Chris Warrick [[pip]][2020-08-19]installrequires vs requirements files — Python Packaging User Guide [[pip]][2019-04-10]kynan/nbstripout: strip output from Jupyter and IPython notebooks [[git]] [[ipython]][2020-08-22]Plotly vs. Bokeh: Interactive Python Visualisation Pros and Cons | Paul Iacomi [[bokeh]] [[viz]]- [[hack to allow optional git dependencies]] [[pip]] [[pypi]]
[2020-03-14]jestem króliczkiem on Twitter: "or, you can encode dependencies in types: @dataclass(init=False) class FancyPath: path: Path mtime: float def _init_(self, path: Path): self.path = path self.mtime = path.stat().stmtime" / Twitter [[cachew]] [[python]][2020-04-11]Traps for the Unwary in Python’s Import System — Nick Coghlan's Python Notes 1.0 documentation [[python]][2020-05-13]amontalenti/elements-of-python-style: Goes beyond PEP8 to discuss what makes Python code feel great. A Strunk & White for Python. [[python]][2020-05-18]The Definitive Guide to Python import Statements | Chris Yeh [[python]][2020-08-09]resize ipython notebook output window - Stack Overflow[2020-01-26]Not really. Enable something like MyPy or PyType on a big enough codebase with z… | Hacker News[2020-07-21]tmbo/questionary: Python library to build pretty command line user prompts ✨Easy to use multi-select lists, confirmations, free text prompts … [[tui]][2020-09-07]Good Integration Practices — pytest documentation[2019-07-23]Python Scatterplot Matrix | Plotly [[viz]][2019-08-18]box/flaky: Plugin for nose or pytest that automatically reruns flaky tests. [[pytest]][2019-03-05]ipython -pylab [[ipython]]-
[2018-12-23]lambdalisue/jupyter-vim-binding: Jupyter meets Vim. Vimmer will fall in love. [[vim]] [[jupyter]] [2019-05-10]Is SQLAlchemy recommended for a highly transactional, large volume database? /r/Python-
[2020-02-16]Command Line Scripts — Python Packaging Tutorial [[pip]] [2019-10-18]Hy - Wikipedia [[lisp]] [[python]][2019-12-18]Python VS Common Lisp, workflow and ecosystem - Lisp journey [[lisp]] [[python]]-
[2019-02-27]When do you us Beautiful Soup or Scrapy? : Python [[scrape]] [[python]] [2019-04-07]DataFrame — pandas 0.24.2 documentation [[pandas]][2019-04-07]Comparison with SQL — pandas 0.24.2 documentation [[pandas]][2019-02-14]There's now a dead simple way to slap a web interface on a command line script : Python (click library) [[tui]] [[web]][2020-05-26]multiprocess.Pool + submitasync work properly with timeouts… unlike concurrent.futures? [[python]][2020-03-08]dataset: right, so synccolumn is taking quite a bit of time… I suppose because of column detection stuff [[sqlite]] [[python]]- [[gotcha with yield]] [[yield]] [[python]]
[2019-07-23]date index [[pandas]] [[python]] [[data]][2019-07-23]Which one is better: Bokeh or Plotly? - Quora [[viz]] [[python]][2019-07-23]Plotly vs Bokeh vs … : Python [[viz]] [[python]][2019-05-18]unwrap vs assert: assert is a statement, so can't do in one line [[python]][2018-11-10]imp.loadsource for loading python module from file [[python]][2018-06-21]Ok, to prevent pollution just assert everything in _all isinstance [[python]][2018-08-26]dill seems to be superior to pickle[2019-02-12]Choosing a Python Visualization Tool - Practical Business Python [[python]] [[viz]]-
[2019-02-12]Quickstart — Bokeh 1.0.4 documentation [[viz]] [2019-02-12]python - how to set readable xticks in seaborn's facetgrid? - Stack Overflow [[plotting]] [[seaborn]][2019-12-12]#45 Control color of each marker | seaborn – The Python Graph Gallery [[seaborn]][2020-01-17]python - Format x-axis on chart created with pandas plot method - Stack Overflow [[drill]] [[pandas]][2020-04-18]screw hatch. it's got some weird defaults and doesn't provide much value [[pip]][2020-02-16]python - Argparse: Way to include default values in '–help'? - Stack Overflow[2019-07-20]I created a GitHub repository explaining the complete process of gathering data, transforming it, getting insights and making plots using pandas, NumPy, Matplotlib and Seaborn. /r/Python [[python]] [[viz]][2020-02-18]google/pytype: A static type analyzer for Python code[2020-01-03]Comparing Python Command-Line Parsing Libraries – Argparse, Docopt, and Click | Hacker News [[python]][2020-10-24]sdispater/pendulum: Python datetimes made easy [[python]] [[datetime]][2020-09-05]fastcore: An Underrated Python Library | fastpages [[python]][2021-01-05]On Repl-Driven Programming | Hacker News [[repl]][2020-11-28]ast — Abstract Syntax Trees — Python 3.9.1rc1 documentation[2019-12-27]Why Python is my Favorite Language • Buttondown[2020-12-17]wrapt · PyPI[2020-12-13]pydot/pydot: Python interface to Graphviz's Dot language [[viz]][2020-12-05]NBSafety Fearless interactivity for Jupyter notebooks[2020-12-29]Top 10 Python libraries of 2020 you should know about | Tryolabs Blog[2020-09-03]Overviews — PyViz 0.0.1 documentation[2020-12-05]fastai/nbdev: Create delightful python projects using Jupyter Notebooks[2020-12-07]Running Python code in a subprocess with a time limit | Simon Willison’s TILs[2020-12-07]tiangolo/typer: Typer, build great CLIs. Easy to code. Based on Python type hints.[2020-11-30]Allow to customize location of .eggs directory · Issue #1854 · pypa/setuptools[2020-10-20]PyInstrument – A statistical Python profile that focuses on the slow parts | Hacker News[2020-11-25]python - Extract traceback info from an exception object - Stack Overflow [[errors]]- [[frustrating: so much duplication]] [[pip]]
[2020-05-28]Hypermodern Python | Lobsters[2020-05-30]The Hard Part of Learning a Language • Hillel Wayne [[toblog]] [[python]]- [[I've gained massive amounts of random Python knowledge over the past month of actively working on my projects]] [[toblog]] [[python]]
[2020-01-04]python - How can I make setuptools install a package that's not on PyPI? - Stack Overflow[2020-04-17]pypa/gh-action-pypi-publish: GitHub Action for publishing pre-built distribution packages to PyPI (from `dist/` dir) [[githubci]][2020-04-18]Publishing package distribution releases using GitHub Actions CI/CD workflows — Python Packaging User Guide [[githubci]][2020-12-22]uva-graphics/autoimp: Automatic Python imports[2020-01-25]My Python setup for 2020 | Noam Elfanbaum https://noamelf.com/posts/my-python-setup-for-2020/[2019-09-17]Vendoring Python dependencies with pip - Underdog.io Engineering Team - Medium https://medium.com/underdog-io-engineering/vendoring-python-dependencies-with-pip-b9eb6078b9c0 [[python]][2020-02-04]PyPy - Performance https://pypy.org/performance.html#profiler[2020-05-03]PEP 612 – Parameter Specification Variables | Python.org[2020-01-06]Please Fix Your Decorators · Homepage of Hynek Schlawack https://hynek.me/articles/decorators/[2019-09-23]bast/somepackage: Show how to structure a Python project. https://github.com/bast/somepackage[2019-11-17]holtzy/The-Python-Graph-Gallery: A website displaying hundreds of charts made with Python https://github.com/holtzy/The-Python-Graph-Gallery [[viz]][2019-12-05]Debugging Jupyter notebooks - David Hamann https://davidhamann.de/2017/04/22/debugging-jupyter-notebooks/[2019-12-13]python-poetry/poetry: Python dependency management and packaging made easy. https://github.com/python-poetry/poetry[2020-12-13]Do You Have Any Offline Programming Techniques or Tools? | Lobsters[2020-02-15]pschanely/CrossHair: A static analysis tool for Python that blurs the line between testing and type systems. https://github.com/pschanely/CrossHair[2020-04-15]egg-info in local directory makes pip think package is installed · Issue #6558 · pypa/pip[2020-04-15]I hate easy-install.pth · Issue #929 · fonttools/fonttools[2020-05-16]macropy: syntactic macros for Python | Lobsters[2020-08-22]Installation — HoloViews 1.13.3 documentation[2021-02-14]ok, naming test modules the same as originals doesn't end up well… [[python]][2021-02-09]python - Using property() on classmethods - Stack Overflow[2021-02-10]Web Scraping 101 with Python | Hacker News- [[–system-site-packages?]] [[pipx]]
- [[strptime idea – cache time string and somehow speed up?]] [[python]]
- [[hmm, maybe possible to self-pack minimal package in setup.py? could work…]] [[python]]
[2021-02-23]Tiendil/smart-imports: smart imports for Python [[python]][2021-02-21]djrobstep/logx: best practice, zero config python logging [[python]] [[logging]][2021-02-23]textwrap — Text wrapping and filling — Python 3.8.5 documentation[2020-04-09]thebjorn/pydeps: Python Module Dependency graphs https://github.com/thebjorn/pydeps [[project]] [[python]][2020-05-15]Hello flake8 • Dimitri Merejkowsky [[pylint]][2020-07-06]Brython – A Python 3 implementation for client-side web programming | Hacker News [[python]] [[js]][2021-03-16]leeoniya/uPlot: 📈 A small, fast chart for time series, lines, areas, ohlc & bars [[python]] [[dataviz]][2021-04-02]cleanup; remove unused imports by seanbreckenridge · Pull Request 151 · karlicoss/HPI [[flake8]][2021-03-23]Iterables vs. Iterators vs. Generators » nvie.com [[python]][2021-03-07]hhatto/autopep8: A tool that automatically formats Python code to conform to the PEP 8 style guide. [[python]][2021-03-20]python - Suspend on exception in pdb - Stack Overflow [[python]] [[debug]]- [[tips about putting test next to code]] [[python]] [[toblog]]
[2021-04-04]How to make an unaware datetime timezone aware in python - Stack Overflow [[tz]][2021-04-06]python - How do I parse an ISO 8601-formatted date? - Stack Overflow[2021-03-30]setuptools - python: simple example for a python egg with a one-file source file? - Stack Overflow [[pip]][2021-04-04]Utilities — Click Documentation (7.x) [[cli]] [[python]][2021-04-16]pythonql/pythonql: A Query Language extension for Python: Query files, objects, SQL and NoSQL databases with a built-in query language [[python]][2021-05-01]PythonPackagingTerminology - Python Wiki [[pip]]
* testing [[testing]]
[2020-03-27] Hypothesis has a set of Pandas strategies for generating data [[pandas]]
https://www.hillelwayne.com/talks/beyond-unit-tests/
[2020-05-05] python - Run code before and after each test in py.test? - Stack Overflow
py.test fixtures are a technically adequate method to achieve your purpose.
You just need to define a fixture like that:
@pytest.fixture(autouse=True)
def run_around_tests():
[2019-08-02] python - How should I structure a pytest test only package? - Stack Overflow [[testing]] [[project]] [[pip]]
https://stackoverflow.com/questions/48111426/how-should-i-structure-a-pytest-test-only-package/48350323#48350323
distribute tests with package..
doctest?
pytest can detect recursion [[pytest]]
* profiling [[performance]]
[2020-03-08] what-studio/profiling: An interactive continuous Python profiler
https://github.com/what-studio/profiling
profiling live-profile webserver.py
ok, this is really nice and easy to use
[2020-07-28] kinda unmaintainerd though?
[2019-07-20] profiling with cprof
python3 -m cProfile -o stats.prof script.py
snakeviz stats.prof
[2020-01-13] rkern/lineprofiler: Line-by-line profiling for Python
https://github.com/rkern/line_profiler
[2018-03-10] profiling
python3 -m cProfile -s tottime process.py | less
sudo apt install kcachegrind
pip3 install --user pyprof2calltree
https://julien.danjou.info/guide-to-python-profiling-cprofile-concrete-case-carbonara/
python -m cProfile -o myscript.cprof myscript.py
pyprof2calltree -k -i myscript.cprof
ipython?
timeit
* packaging [[pip]]
[2020-04-02] minimal-setup-py/setup.py at master · maet3608/minimal-setup-py
https://github.com/maet3608/minimal-setup-py/blob/master/setup.py
install only dependencies: pip3 install --user -e .
install multiple packages at once
ok, apparently pip does use some sort of 'set compiling', so worth doing that
https://github.com/pypa/pip/issues/988
[2020-04-24] local PIP dependency: if the repo is in /path/to/repo, put HPI@git+file://DUMMY/path/to/repo@master in setup.py [[pip]]
no idea why you need DUMMY bit, must be some parsing quirk :shrug:
also, sometimes it needs //DUMMY, sometimes ///DUMMY ???
[2019-12-15] bast/pypi-howto: How to publish Python packages on PyPI. [[pypi]]
https://github.com/bast/pypi-howto
[2019-07-02] Testing & Packaging · Homepage of Hynek Schlawack
https://hynek.me/articles/testing-packaging/
Your tests do not run against the package as it will be installed by its users. They run against whatever the situation in your project directory is.
[2019-07-25] o
To achieve that, you just move your packages into a src directory and add a where argument to find_packages() in your setup.py:
setup(
[...]
packages=find_packages(where="src"),
package_dir={"": "src"},
)
releasing on pypi [[pypi]]
ok, that seems to be way easier
hatch build --clean --verbose
hatch release --strict "$@"
* debugging [[debug]]
[2019-04-09] with ipdb.launch_ipdb_on_exception() [[habit]]
[2019-12-05] python3.7 has a breakpoint() builtin + more https://hackernoon.com/python-3-7s-new-builtin-breakpoint-a-quick-tour-4f1aebc444c
ipdb pp for pretty print [[habit]]
* bad things about python
-
lambdas suck
- statements, not expressions, you are essentially restrictet to a single line
- no local variables in lambdas (although with walrus operation it's a bit better now)
- http://math.andrej.com/2009/04/09/pythons-lambda-is-broken
- scoping (i.e. only local and global scopes)
- GIL makes the concurrency very annoying at times
- no static typing (although it's kinda okay now with annotations and #mypy)
* static analysers
monkeytype – automatic typing annotations generation [[mypy]]
would be nice to have static analysis that checks you are not using global variables, etc.
however there are not any tools which do that…
bandit – security checks [[security]]
https://github.com/openstack/bandit
[2021-01-16] wouldn't say it's super useful… might detect occasional eval or whatever, but won't help with more sophisticated stuff
* libraries
[2019-04-02] peopledoc/workalendar: Worldwide holidays and workdays computational toolkit.
https://github.com/peopledoc/workalendar
[2018-12-09] Altair: Declarative Visualization in Python — Altair 2.3.0 documentation [[viz]]
https://altair-viz.github.io/index.html
* Import system
figure it out – very confusing!
[2017-12-17] from . import module
local import
[2020-01-17] Alone Djangonaut – How python's import machinery works
https://manikos.github.io/how-pythons-import-machinery-works
origin
[2019-06-29] python - Relative imports for the billionth time - Stack Overflow
https://stackoverflow.com/questions/14132789/relative-imports-for-the-billionth-time
.. are only relative in a package
However, if your module's name is __main__, it is not considered to be in a package. Its name has no dots, and therefore you cannot use from .. import statements inside it. If you try to do so, you will get the "relative-import in non-package" error.
[2019-06-11] relative imports are discouraged
* datetime handling [[datetime]]
[2018-09-04] utcfromtimestamp – returns timestamp, unaware; fromtimestamp – returns offset + timestamp, unaware
In : datetime.fromtimestamp(123)
Out: datetime.datetime(1970, 1, 1, 4, 2, 3)
In : datetime.utcfromtimestamp(123)
Out: datetime.datetime(1970, 1, 1, 0, 2, 3)
[2018-09-04] ok, seems that it's better to use pytz.utc.localize(tz_unaware_datetime)
[2020-05-02] zachwill/moment: Dealing with dates in Python shouldn't have to suck.
# Create a moment with words in it
moment.date("December 18, 2012")
[2020-05-02] zachwill/moment: Dealing with dates in Python shouldn't have to suck.
# Create a moment that would normally be pretty hard to do
moment.date("2 weeks ago")
* logging [[logging]]
[2018-07-05] creating top level logger is always bad (may happen before configuring). use factory method [[logging]]
* docs
pydoc
-k: keyword search
-g: gui
ipython: ? and ??
* ipdb [[ipdb]]
related #repl
[2019-04-09] python - Use IPython magic functions in ipdb shell - Stack Overflow
https://stackoverflow.com/questions/16184487/use-ipython-magic-functions-in-ipdb-shell
shell.find_line_magic('cpaste')()
----
[2019-09-22] Python3 f-strings - A complete guide to the most well received feature of Python 3. /r/Python
That’s a part of python’s data model like `len`, `reversed`, `iter`, …:
`datetime` simply defines [`datetime.__format__`](https://docs.python.org/3/library/datetime.html#datetime.date.__format__). The method [is explained here](https://docs.python.org/3/reference/datamodel.html#object.__format__).
[2019-05-11] To yield or not to yield [[yield]]
https://barahilia.github.io/blog/computers/2017/01/04/to-yield-or-not-to-yield.html
Finally we came to this. To me it is more important that generators make code more elegant. Performance is usually relevant to smaller hot spots.
The idea is simple: in comparison to list interface where computation results are first saved and are returned only at the end, “yielding” could reach faster code and reduce memory usage. As a quick simulation we may use %timeit magic command in IPython with the following two functions:
[2019-07-30] good point about separating validation and generation
AST ast.dump(ast.parse("'a' in 'aa' in 'aaa'"))
use for – else [[habit]]
[2018-06-18] log optimizers i used
[2018-06-11] optimizing python CLI tools https://files.bemusement.org/talks/OSDC2008-FastPython/
interpreter – about 10ms
lazy imports
profile slow imports
parser.addargument('rest, nargs=argparse.REMAINDER) [[habit]]
process remaining arguments
awesome-python https://github.com/vinta/awesome-python
attrs – could be interesting… might solve stupid namedtuple addition etc.
https://github.com/python-attrs/attrs
This gives you the power to use actual classes with actual types in your code instead of confusing tuples or confusingly behaving namedtuples. Which in turn encourages you to write small classes that do one thing well. Never again violate the single responsibility principle just because implementing init et al is a painful drag.
should definitely subscribe to its feed and go through again
https://github.com/vinta/awesome-python#command-line-tools
pretty cool https://github.com/timofurrer/try
cool https://github.com/dbcli/mycli
hmm try that? http://docopt.org/
some of these for nutrino? https://github.com/vinta/awesome-python#database
hmm that's interesting, visual scraping https://github.com/scrapinghub/portia
https://www.reddit.com/r/coolgithubprojects/
?? https://python.libhunt.com/
do not use replace tzinfo, always localize.. [[habit]]
[2019-01-01] multiline string – lstrip('\n') for nicer formatting!
[2019-03-20] Tweet from Vladislav Isenbaev (@isenbaev), at Mar 20, 03:48: pickle просто скотски медленный, если что - кратно медленнее даже json'а
https://twitter.com/isenbaev/status/1108213595920166912
[2019-08-11] multiprocessing vs multithreading vs asyncio in Python 3.4 - Stack Overflow [[concurrency]] [[performance]]
if io_bound:
if io_very_slow:
print("Use Asyncio")
else:
print("Use Threads")
else:
print("Multi Processing")
[2020-01-03] adamchainz/patchy: Patch the inner source of python functions at runtime. [[lisp]]
https://github.com/adamchainz/patchy#patchy
Patch the inner source of python functions at runtime.
[2019-12-31] PyPy.js: Python in the web browser | Hacker News [[js]] [[webext]]
https://news.ycombinator.com/item?id=17819138
[2018-06-22] difflib.unified_diff is suuuuper slow…
[2018-04-21] scrapy debugging [[scrapy]]
scrapy shell
withsecrets scrapy shell
from scrapy.http import FormRequest
request=FormRequest(url='http://www.quantified-mind.com/login',formdata={'Email': USER,'Password':PASSWORD,})
fetch(request) – redirects by default
sets response variable
you can do view(response) to view in browser
mind that it might be different from browsing in chrome. because of user agent?
[2018-08-30] python's for..else makes in 'syntactially' look like a total function
NamedTuple
use typing.NamedTuple
watch out for default add and mul, it acts as adding pairs
you can't easily overload init, so make types of fields robust. Use a helper method instead
def N(*args, **kwargs):
reurn NamedTuple(whatevs)
Use contextmanager
- @contextmanager; prepare; yield exactly once, then shutdown
contextlib.redirect_stdout
meh. I think it patches sys module? so it redirects sys.stdout calls only; but not all stdout
[2018-12-08] get current function/method name
def fname():
import inspect
return inspect.stack()[1][3]
traitlets?
[2019-04-30] What's the difference between marshmallow and sql-alchemy? /r/flask
Marshmallow “converts” (deserializes) dicts to SQLAlchemy models or serializes SQLAlchemy models to dicts.
SQLAlchemy is an ORM. It maps database schema (tables) and data to Python objects.
The two packages complement each other. They cannot and do not replace each others’ functionality.
Flask-Marshmallow gives you a convenient interface to Marshmallow under Flask.
[2019-06-29] dominatepp/.travis.yml at master · karlicoss/dominatepp [[ci]]
https://github.com/karlicoss/dominatepp/blob/master/.travis.yml
hmm, minimalistic travis is not so bad..
[2019-08-12] use re.VERBOSE for inline comments in regexes
[2019-10-21] python - What do (lambda) function closures capture? - Stack Overflow [[plt]]
https://stackoverflow.com/questions/2295290/what-do-lambda-function-closures-capture
Scoping in Python is dynamic and lexical. A closure will always remember the name and scope of the variable, not the object it's pointing to.
[2019-12-30] argparse — Parser for command-line options, arguments and sub-commands — Python 3.8.1 documentation
https://docs.python.org/3/library/argparse.html
metavar - A name for the argument in usage messages.
[2020-01-07] Performance — python-rapidjson 0.4 documentation [[json]]
https://python-rapidjson.readthedocs.io/en/latest/benchmarks.html
ok, so loads speedups are not that significant for my purposes
[2019-07-19] python - Argparse: Way to include default values in '–help'? - Stack Overflow
Add '%(default)' to the help parameter to control what is displayed.
[2019-12-31] PyPy - packages http://packages.pypy.org [[pypy]]
Construct: kinda like struct but better? https://construct.readthedocs.io/en/latest/ [[parsing]]
Pyrser: grammars? https://pythonhosted.org/pyrser/ [[parsing]]
[2019-07-21] kython@git+https://github.com/karlicoss/kython.git@master dependency for setup.cfg [[pip]]
[2018-07-22] PyCon 2018 Talk Videos : Python https://www.reddit.com/r/Python/comments/8j4ep6/pycon_2018_talk_videos/ [[towatch]]
[2019-08-02] Basic usage — tox 3.13.3.dev13 documentation
https://tox.readthedocs.io/en/latest/example/basic.html#integration-with-setup-py-test-command
As the python eco-system rather moves away from using setup.py as a tool entry point it’s maybe best to not go for any setup.py test integration.
[2018-06-12] if there is a 'main.py' in script dir, it gets imported – wtf????
(while debugging telegram2org)
[2019-07-20] concurrent.futures https://docs.python.org/3.7/library/concurrent.futures.html?highlight=processpoolexecutor use map
[2019-08-11] PyCQA/pyflakes: A simple program which checks Python source files for errors
https://github.com/PyCQA/pyflakes
Pyflakes makes a simple promise: it will never complain about style, and it will try very, very hard to never emit false positives.
Pyflakes is also faster than Pylint or Pychecker. This is largely because Pyflakes only examines the syntax tree of each file individually. As a consequence, Pyflakes is more limited in the types of things it can check.
[2019-08-02] posargs are needed to passing adhoc args, e.g. [[tox]]
https://tox.readthedocs.io/en/latest/example/general.html#interactively-passing-positional-arguments
[2018-04-17] some misc notes
## Print with @padding
`print("{:>d}{}".fomat(i, a[i]))` prints i aligned to at least two spaces as a decimal.
## Infinite dict
~~~ { .python }
infinite_defaultdict = lambda: defaultdict(infinite_defaultdict)
d = infinite_defaultdict()
d['x']['y']['z'] = 10
~~~
## Web server
to start a webserver to serve files from your current dir: python -m SimpleHTTPServer
@enums
## Enums
from enum import Enum
class Fruit(Enum):
APPLE = 0
ORANGE = 1
## Generating @random color
color = "#%06x" % random.randint(0, 0xFFFFFF)
python setup.py install --force
#singleton
@singleton
def singleton(cls):
instances = {}
def get_instance():
if cls not in instances:
instances[cls] = cls()
return instances[cls]
return get_instance
TODO tbh, easier with lru_cache(1)?
from http import HTTPStatus
[2018-01-21] use nonlocal instead of global [[habit]]
!r formatter [[habit]]
[2019-04-22] yield is often preferrable because python doesn't have bindings in generators
[2019-05-01] there is a difference between returning generator and yield from generator. the latter keeps scope, which might be useful if you have open files
[2019-07-30] To yield or not to yield [[decorator]]
https://barahilia.github.io/blog/computers/2017/01/04/to-yield-or-not-to-yield.html
hmm. if I decorate function with list constructor, I can get both ease of use and yield in function's body
[2019-07-30] huh, some things are mentioned in the original post actually
use putup (pyscaffold) for project generation [[habit]]
Poetry instead of pyscaffold? [[python]]
The best answer in 2020 is to use poetry.
http://poetry.eustace.io
[2021-01-16] eh, don't think it worked for me, I prefer to rely on setup.py
[2019-08-25] https://docs.python.org/3.7/library/argparse.html argparse: use set_defaults
One particularly effective way of handling sub-commands is to combine the use of the add_subparsers() method with calls to set_defaults() so that each subparser knows which Python function it should execute. For example:
This way, you can let parse_args() do the job of calling the appropriate function after argument parsing is complete. Associating functions with actions like this is typically the easiest way to handle the different actions for each of your subparsers. However, if it is necessary to check the name of the subparser that was invoked, the dest keyword argument to the add_subparsers() call will work:
[2019-09-02] ah, could pass lambda to forward to actual handler function!
generateordering? [[python]]
[2020-07-05] How can I color Python logging output? - Stack Overflow [[logging]] [[kython]]
2020 code, no additional packages required, Python 3
[2020-02-16] Direct URL PEP 508 support and installing sub-dependencies from Git · Issue 5566 · pypa/pip [[pip]]
https://github.com/pypa/pip/issues/5566#issuecomment-402417467
We disabled the ability to use PEP 508 URL requirements in dependencies, since we don't want that a package installed from PyPI to result in the pip reaching out to an arbitary web URL. Basically, pip install spam should not make pip reach out to anything except PyPI.
[2020-02-16] Allow direct urls in installrequires · Issue 6301 · pypa/pip [[python]]
https://github.com/pypa/pip/issues/6301
ugh. so I can't have URL dependencies if it's meant to be on pypi???
[2019-07-25] rstojnic/lazydata: Lazydata: Scalable data dependencies for Python projects
https://github.com/rstojnic/lazydata
[2020-03-27] so it kinda keeps textual 'submodules' for data??
using pytest fixtures to inject stuff into the module [[python]] [[pytest]]
[2019-08-02] like in tz provider
end2end gui semi manual tests [[promnesia]] [[python]] [[testing]]
pytest dependencies [[python]]
py, more-itertools, zipp, importlib-metadata, pluggy, six, pyparsing, packaging, atomicwrites, wcwidth, attrs, pytest, orger
[2019-12-31] backoff · PyPI
https://pypi.org/project/backoff/
It is also possible to specify an alternate logger with the logger keyword argument. If a string value is specified the logger will be looked up by name.
Poetry for dep management [[python]]
We have moved our dependency management from pipenv to poetry and hasn’t been more happier than now working with and publish Python modules.
Now we use pyenv with poetry to run all our projects in Python with venv in project instead of decided by poetry default settings. We changed the settings with:
poetry config settings.virtualenvs.in-project true After this in hgignore or gitignore added .venv folder.
Now everything is the way we wanted, with Pipenv many times faced issues that the project worked with requirements.txt but not in Pipenv. Didn’t have this issue moving to poetry yet.
Also with emacs support and automated deployment tools the predictability of poetry made our team easy to work with and publish Python application modules.
[2019-12-15] Support automatic versioning setuptoolsscm-style? · Issue 140 · python-poetry/poetry
https://github.com/python-poetry/poetry/issues/140
right, poetry can't infer version...
it's clearly not detecting changes in install_requires; needed to reinsall [[tox]]
[2019-07-26] python - pytest exits with no error but with "collected 0 items" - Stack Overflow [[pytest]]
https://stackoverflow.com/questions/37353960/pytest-exits-with-no-error-but-with-collected-0-items
pytest gathers tests according to a naming convention. By default any file that is to contain tests must be named starting with test_ and any function in a file that should be treated as a test must also start with test_.
[2019-10-26] traceback — Print or retrieve a stack traceback — Python 3.8.0 documentation [[errors]]
https://docs.python.org/3/library/traceback.html#tracebackexception-objects
TracebackException Objects
hmm, could use that?
separate testing and linting since mypy's deps might be installed by accident? [[python]] [[tox]]
[2019-11-09] python - Run an OLS regression with Pandas Data Frame - Stack Overflow
https://stackoverflow.com/questions/19991445/run-an-ols-regression-with-pandas-data-frame
I think you can almost do exactly what you thought would be ideal, using the statsmodels package which was one of pandas' optional dependencies before pandas' version 0.20.0 (it was used for a few things in pandas.stats.)
figure out a better framework for python multiprocessing… [[python]]
[2019-09-01] vinta/awesome-python: A curated list of awesome Python frameworks, libraries, software and resources [[tui]]
https://github.com/vinta/awesome-python
urwid - A library for creating terminal GUI applications with strong support for widgets, events, rich colors, etc.
sigh… don't think it's possible to properly preserve stacktraces… [[python]] [[errors]]
import logging
logging.basicConfig()
def bad():
raise RuntimeError('BAD')
xx = RuntimeError('while running "test"')
ex = None
try:
bad()
except Exception as e:
ex = e
ex.__cause__ = xx
logging.error('inside!')
logging.exception(ex)
logging.error('outside! note the empty stacktrace :(')
logging.exception(ex)
logging.error("also __cause__ is ignored even though it's present: '%s'", ex.__cause__)
# I guess it just doesn't use __cause__, only traceback information...
test()
strptime is incapable of handling timezones via %Z direcive?? [[python]] [[timezone]]
In [20]: ds = "Sep 18 2018 5:48:23 UTC"
In [21]: _TIME_FORMAT = "%b %d %Y %H:%M:%S %Z"
In [22]: datetime.strptime(ds, _TIME_FORMAT)
Out[22]: datetime.datetime(2018, 9, 18, 5, 48, 23)
fucking hell..
[2020-03-27] see takeout provider
[2020-03-12] encode/httpx: A next generation HTTP client for Python. 🦋
https://github.com/encode/httpx
HTTPX is a fully featured HTTP client for Python 3, which provides sync and async APIs, and support for both HTTP/1.1 and HTTP/2.
[2020-09-02] Python Prompt Toolkit 3.0 — prompttoolkit 3.0.2 documentation [[tui]] [[python]]
[2020-09-18] testing - Python/tox Install a dependency as editable - Stack Overflow [[python]] [[tox]] [[pip]]
how to install a dependency as editable
[2020-09-18] testing - Python/tox Install a dependency as editable - Stack Overflow [[hpi]]
add this to developer guide.. fucking hell
[2020-09-27] python - What is the difference between venv, pyvenv, pyenv, virtualenv, virtualenvwrapper, pipenv, etc? - Stack Overflow
pipenv- like venv - can be used to create virtual envelopes but additionally rolls-in package management and vulnerability checking functionality. Instead of using requirements.txt, pipenv delivers package management via Pipfile. As PyPA endorses pipenv for PACKAGE MANAGEMENT, that would seem to imply pipfile is to supplant requirements.txt.
HOWEVER: pipenv uses virtualenv as its tool for creating virtual envelopes, NOT venv which is endorsed by PyPA as the go-to tool for creating virtual envelopes.
adapter thigs with getattr (like in workout provider for org notes) – pretty great for adding one missing method [[python]]
[2019-08-25] argparseweb · PyPI
https://pypi.org/project/argparseweb
[2019-09-01] vinta/awesome-python: A curated list of awesome Python frameworks, libraries, software and resources [[cli]]
https://github.com/vinta/awesome-python
Command-line Interface Development
Libraries for building command-line applications.
Command-line Application Development
[2019-08-02] GrahamDumpleton/wrapt: A Python module for decorators, wrappers and monkey patching.
https://github.com/GrahamDumpleton/wrapt
It therefore goes way beyond existing mechanisms such as functools.wraps() to ensure that decorators preserve introspectability, signatures, type checking abilities etc. Th
attemt to figure out mixed sem/cal versioning [[project]] [[pip]]
https://github.com/pypa/setuptools_scm/#default-versioning-scheme
def semcal(v):
tag = v.tag.base_version
assert len(tag.split('.')) == 2, tag
v.time
# tag is
breakpoint()
pass
if __name__ == '__main__':
[pkg] = find_packages('src')
setup(
name=pkg,
# version='0.1.1',
# use_scm_version=True,
use_scm_version={
'version_scheme': semcal,
},
setup_requires=['setuptools_scm'],
had to remore username from hatch config? it was overriding token during the release.. [[pypi]]
[2020-03-31] why it is hard – if you have 2fa you can't upload packages [[pypi]]
[2020-03-31] ah ok, actually it allows for a token, so even better!
[2019-12-15] tox support python-poetry/poetry
https://github.com/python-poetry/poetry/issues/222
For now, you can use poetry with tox by using something similar to what I did in pendulum: https://github.com/sdispater/pendulum/blob/master/tox.ini
findpackages in setup.py? [[python]]
Although, beware that you may need to change `find_packages()` to `find_namespace_packages()` in your setup.py.
I get burned by that one a lot!
eee [[ipython]]
ldisplay_md("hi")
TODO shit. try and work on it?
also provide these as utils..
from IPython.display import display, Latex
display(Markdown("Heat equation:"), heat_eq)
display(Markdown("Boundary conditions:"))
display(Latex(r"\begin{cases} x \\ y \end{cases}"), bc_left, bc_right)
display(Markdown('hi'))
That doesn't look great. `display` is quoting plain
[2019-09-01] KoffeinFlummi/Chronyk: A Python 3 library for parsing human-written times and dates
https://github.com/KoffeinFlummi/Chronyk
[2019-11-17] sampleproject/setup.py at master · pypa/sampleproject
https://github.com/pypa/sampleproject/blob/master/setup.py
# This field corresponds to the "Description-Content-Type" metadata field:
# https://packaging.python.org/specifications/core-metadata/#description-content-type-optional
long_description_content_type='text/markdown', # Optional (see note above)
nicer attribute errors [[python]]
AttributeError: unexpected attribute 'color' to Line, similar attributes are line_color
would be nice to do this hpi:
[2019-07-25] pytest-profiling · PyPI
https://pypi.org/project/pytest-profiling/
Poetry easy pip publishing
Even putting aside it's approach to dependency management, Poetry has a fond place in my heart for making it so much easier to publish to PyPI.
If poetry did nothing but simply the process of publishing and updating python packages, it would still be an amazing tool.
use quit instead of close? [[selenium]]
[2020-10-06] Brython [[python]] [[web]]
Speed of execution is similar to CPython for most operations.
[2020-01-09] logzero: Python logging made easy — logzero 1.5.0 documentation
https://logzero.readthedocs.io/en/latest/
logzero.setup_logger(name=None, logfile
marshmallow for db handling looks interesting… [[python]]
https://github.com/marshmallow-code/marshmallow
zoopla/zoopla/schemas.py
PandaPy
PandaPy has the speed of NumPy and the usability of Pandas - https://news.ycombinator.com/item?id=22142869
[2019-10-27] Ability to execute certain tests sequentially while using -n (xdist) · Issue #385 · pytest-dev/pytest-xdist
https://github.com/pytest-dev/pytest-xdist/issues/385
Isn't this enough?
py.test -m sequential
py.test -m "non sequential" -n8
[2019-10-27] pylint exceed maximum recursion depth · Issue #2388 · PyCQA/pylint
https://github.com/PyCQA/pylint/issues/2388
Thanks for the tip. I actually had that setting before and still keep it on. --extension-pkg-whitelist=numpy
However, after upgrading to later versions of python and pylint and astroid I no longer have the issue even with the numpy whitelist setting.
Python 3.7.1
pylint 2.3.1
astroid 2.2.5
[2019-10-27] Search pylint configuration in setup.cfg and pyproject.toml · Issue #617 · PyCQA/pylint
https://github.com/PyCQA/pylint/issues/617#event-2701192212
Search pylint configuration in setup.cfg and pyproject.toml
[2019-11-08] How do I use regex in a SQLite query? - Stack Overflow [[sqlite]]
https://stackoverflow.com/questions/5071601/how-do-i-use-regex-in-a-sqlite-query
With python, assuming con is the connection to SQLite, you can define the required UDF by writing:
con.create_function('regexp', 2, lambda x, y: 1 if re.search(x,y) else 0)
-pdbcls=IPython.terminal.debugger:TerminalPdb –pdb [[python]] [[ipython]] [[debug]]
wonder how to make sure dataclasses are represented very effecienly? [[python]]
[2020-06-07] Types at the edges in Python – MeadSteve's Dev Blog [[python]]
Pydantic checks that each key I expected exists and is of the correct type. So now all the assumptions I’ve made about the shape of the data is a runtime contract, expressed in native python. If in production it turns out that description is, in fact, optional I’ll get a very descriptive error and the code will fail early.
figuring out why has the package ended up in path [[python]]
d for d in sorted(pkg_resources.working_set, key=lambda p: p.project_name)]
[2020-12-08] Exhaustiveness Checking with Mypy | Haki Benita [[python]] [[mypy]]
Exhaustiveness Checking
use else clause with NoReturn, then mypy assists in refining
hvplot: clever algebra on plots [[bokeh]]
wow! * (same plot) vs + (different plots) is pretty clever!
also I like how multiplication doesn't commute so the 'first' plot wins the layout parameters
[2020-04-09] naiquevin/pipdeptree: A command line utility to display dependency tree of the installed Python packages [NOT ACCEPTING PRs FOR A WHILE BECAUSE OF MAJOR REFACTORING IN ANOTHER BRANCH]
https://github.com/naiquevin/pipdeptree
[2020-04-23] pandas/setup.py at master · pandas-dev/pandas [[pip]]
Docum
[2020-05-09] nice, pandas is using quite elaborate setup.py with proper documentation links
[2019-07-28] kirankoduru/scrapy-programmatically: Running scrapy spider programmatically. [[scrape]]
https://github.com/kirankoduru/scrapy-programmatically
[2020-04-23] detect all subpackages properly · karlicoss/promnesia@f7451c4
tests/integration_test.py::test_example_config
/Users/runner/runners/2.169.1/work/promnesia/promnesia/.tox/py3/lib/python3.7/site-packages/hug/use.py:185: DeprecationWarning: invalid escape sequence \d
status_code = int("".join(re.findall("\d+", response.status)))
[2020-04-05] Configs suck? Try a real programming language | Hacker News
https://news.ycombinator.com/item?id=22787332
mjw1007 28 minutes ago [-]
One variant of this is to use Python syntax but parse it with the `ast` module rather than evaluating it.
This avoids the security problems and the risk that someone will start to write programs inside the configuration file, but gives you the reasonably nice and powerful syntax.
[2020-10-14] google/python-fire: Python Fire is a library for automatically generating command line interfaces (CLIs) from absolutely any Python object. [[cli]]
ython Fire is a library for automatically generating command line interfaces (CLIs) from absolutely any Python object.
[2020-04-23] samuelhwilliams/Eel: A little Python library for making simple Electron-like HTML/JS GUI apps [[gui]]
[2020-04-15] setuptools/_init_.py at master · pypa/setuptools
why is it not including files at all??
keeping testss side by side with code [[pytest]]
import sys
# make sure it doesn't need pytest in prod
if 'pytest' in sys.modules:
import pytest # type: ignore
else:
from unittest.mock import Mock
pytest = Mock()
[2020-04-30] pkgutil — Package extension utility — Python 3.8.3rc1 documentation
pkgutil.extend_path(path, name)
Extend the search path for the modules which comprise a package. Intended use is to place the following code in a package’s __init__.py:
from pkgutil import extend_path
__path__ = extend_path(__path__, __name__)
This will add to the package’s __path__ all subdirectories of directories on sys.path named after the package. This is useful if one wants to distribute different parts of a single logical package as multiple directories.
[2020-03-24] PEP 593 – Flexible function and variable annotations | Python.org
https://www.python.org/dev/peps/pep-0593/
[2019-08-24] Simple dependent types in Python - DEV Community 👩💻👨💻 [[mypy]] [[python]]
https://dev.to/wemake-services/simple-dependent-types-in-python-4e14
Now, we are going to combine our new knowledge about Literal and @overload together to solve our problem with open. At last!
[2020-07-08] SymPy - a Python library for symbolic mathematics | Hacker News [[sympy]] [[sage]]
As one point of comparison, SymPy is comically slow compared to Sage. This is mostly because SymPy is purely Python; Sage on the other hand uses a derivative of GiNaC [1] for its internal symbolic expression representation, and then multiple external libraries for non-trivial operations. Symbolic transformations are mostly Maxima [3]. Sage literally converts expressions to strings, pipes them through a Maxima process, and then parses the result back. This is still much faster than the pure Python SymPy.
There is an effort to speed up SymPy core, SymEngine [3], but it's been in development for years now, and still isn't integrated into SymPy. Not sure why.
Case in point: 'expand("(2+3x+4x*y)^60")' takes 5 seconds with SymPy; Sage does the same in 0.02 seconds.
[2020-07-26] The Qt Console for Jupyter — Jupyter Qt Console 4.7.5 documentation
The Qt console is a very lightweight application that largely feels like a terminal, but provides a number of enhancements only possible in a GUI, such as inline figures, proper multi-line editing with syntax highlighting, graphical calltips, and much more. The Qt console can use any Jupyter kernel.
[2020-10-15] Frame Hacks [[python]]
[2019-03-17] pylint useful stuff [[python]]
cell-var-from-loop -- can detect bad lambda capturing
pylint --disable='C,fixme,'
try using devpi for uploading? [[tox]]
[2020-05-25] docopt v argparse • Dimitri Merejkowsky [[python]]
But for big projects with lots of subcommands, written in Python, using argparse may be a better idea, especially if you need to do advanced stuff for your parsing, like configuring common options in one function, allow plug-ins to change the command line API, and so on …
[2019-12-08] Dynamically change slots in Python 3 - Stack Overflow [[python]]
https://stackoverflow.com/questions/27907373/dynamically-change-slots-in-python-3
Normally, an object's attributes are stored in a dict, which requires a fair bit of memory itself. If you are creating millions of objects then the space required by these dicts becomes prohibitive. __slots__ informs the python machinery that makes the class object that there will only be so many attributes refered to by instances of this class and what the names of the attributes will be. Therefore, the class can make an optimisation by storing the attributes directly on the instance rather than in a dict. It places the memory for the (pointers to the) attributes directly on the object, rather than creating a new dict for the object.
[2020-10-24] LiveCode is a modern day HyperCard (2019) | Hacker News [[python]] [[gui]]
In the spirit of HN contrarian comments, I'd say the closest thing spiritually to a modern-day HyperCard is PySimpleGUI: https://github.com/PySimpleGUI
[2020-01-15] Show HN: CrossHair – SMT Assisted Testing for Python [[testing]] [[python]]
https://github.com/pschanely/CrossHair
[2019-11-10] lihaoyi/macropy: Macros in Python: quasiquotes, case classes, LINQ and more! [[macro]] [[python]] [[lisp]]
https://github.com/lihaoyi/macropy
[2020-05-16] wow that's amazing https://macropy3.readthedocs.io/en/latest/discussion.html#function-advice
[2020-01-09] What does it do? — Logbook [[python]] [[logging]]
https://logbook.readthedocs.io/en/stable/features.html#advantages-over-logging
[2019-11-24] How formulas work — patsy 0.5.1+dev documentation
https://patsy.readthedocs.io/en/latest/formulas.html
The formula language is actually fairly simple once you get the hang of it, but if you’re ever in doubt as to what some construction means, you can always ask Patsy how it expands.
[2019-12-20] Pipenv: promises a lot, delivers very little | Chris Warrick [[pip]]
https://chriswarrick.com/blog/2018/07/17/pipenv-promises-a-lot-delivers-very-little/
[2020-08-19] installrequires vs requirements files — Python Packaging User Guide [[pip]]
Requirements Files described most simply, are just a list of pip install arguments placed into a file.
Whereas install_requires defines the dependencies for a single project, Requirements Files are often used to define the requirements for a complete Python environment.
Whereas install_requires requirements are minimal, requirements files often contain an exhaustive listing of pinned versions for the purpose of achieving repeatable installations of a complete environment.
Whereas install_requires requirements are “Abstract”, i.e. not associated with any particular index, requirements files often contain pip options like --index-url or --find-links to make requirements “Concrete”, i.e. associated with a particular index or directory of packages. 1
Whereas install_requires metadata is automatically analyzed by pip during an install, requirements files are not, and only are used when a user specifically installs them using pip install -r.
[2019-04-10] kynan/nbstripout: strip output from Jupyter and IPython notebooks [[git]] [[ipython]]
https://github.com/kynan/nbstripout
[2020-08-22] Plotly vs. Bokeh: Interactive Python Visualisation Pros and Cons | Paul Iacomi [[bokeh]] [[viz]]
pretty good comparizon
hack to allow optional git dependencies [[pip]] [[pypi]]
def building_for_pypi() -> bool:
return sys.argv[1] == 'sdist'
for_pypi = building_for_pypi()
'my': [] if for_pypi else ['HPI @ git+https://github.com/karlicoss/my.git'],
},
[2020-03-14] jestem króliczkiem on Twitter: "or, you can encode dependencies in types: @dataclass(init=False) class FancyPath: path: Path mtime: float def _init_(self, path: Path): self.path = path self.mtime = path.stat().stmtime" / Twitter [[cachew]] [[python]]
https://twitter.com/karlicoss/status/1238791294547353601
@dataclass
(init=False)
class FancyPath:
path: Path
mtime: float
def __init__(self, path: Path):
self.path = path
self.mtime = path.stat().st_mtime
right, I suppose it's type to use dataclasses
[2020-04-11] Traps for the Unwary in Python’s Import System — Nick Coghlan's Python Notes 1.0 documentation [[python]]
[2020-05-13] amontalenti/elements-of-python-style: Goes beyond PEP8 to discuss what makes Python code feel great. A Strunk & White for Python. [[python]]
Use parens (...) for fluent APIs
[2020-05-18] The Definitive Guide to Python import Statements | Chris Yeh [[python]]
[2020-08-09] resize ipython notebook output window - Stack Overflow
You can toggle the scroll window in the main menu of the notebook
Cell -> Current Outputs -> Toggle Scrolling
[2020-01-26] Not really. Enable something like MyPy or PyType on a big enough codebase with z… | Hacker News
https://news.ycombinator.com/item?id=21902827
Not really. Enable something like MyPy or PyType on a big enough codebase with zero explicit annotation and it'll already find plenty of bugs and unhandled cases from the inferred types alone. Some of these are stuff a strong IDE may catch too (using the wrong function name, passing wrong number of args, etc), but some other ones are actually deeper in the code.
So already, with zero annotations, you already get value out, let alone once you type a few tricky variables that are harder for Python to track.
[2020-07-21] tmbo/questionary: Python library to build pretty command line user prompts ✨Easy to use multi-select lists, confirmations, free text prompts … [[tui]]
[2020-09-07] Good Integration Practices — pytest documentation
tests in a separate dir vs tests in a subpackage
[2019-07-23] Python Scatterplot Matrix | Plotly [[viz]]
[2019-08-18] box/flaky: Plugin for nose or pytest that automatically reruns flaky tests. [[pytest]]
[2019-03-05] ipython -pylab [[ipython]]
[2018-12-23] lambdalisue/jupyter-vim-binding: Jupyter meets Vim. Vimmer will fall in love. [[vim]] [[jupyter]]
https://github.com/lambdalisue/jupyter-vim-binding
[2019-04-13] eh, I'm using emacs now…
[2019-05-10] Is SQLAlchemy recommended for a highly transactional, large volume database? /r/Python
Yes. I've written a few systems using SQLAlchemy that see 50-100k writes and 200k or so reads per second, and as long as you're using the Core everything works fine. Also allows you to use the ORM for ease-of-development on bits that don't need performance.
SQLAlchemy is probably the one library in which I've never reached the "wait, I need to do something and can't" point. Every single weird edge case I've had to handle has been supported either natively or by being able to access the raw interfaces directly in a clean way. Fantastic library, can't recommend it more highly.
Also, the lead dev is extremely responsive on the google group and is more than happy to answer questions.
[2020-02-16] Command Line Scripts — Python Packaging Tutorial [[pip]]
[2020-12-14] hmm maybe best to use 'scripts', seems more manageable
[2019-10-18] Hy - Wikipedia [[lisp]] [[python]]
https://en.wikipedia.org/wiki/Hy
[2019-12-18] Python VS Common Lisp, workflow and ecosystem - Lisp journey [[lisp]] [[python]]
https://lisp-journey.gitlab.io/pythonvslisp
don't feel like it's very objective comparison.
lots of things are picked etc
although I'm not very positive towards lisp either
[2019-02-27] When do you us Beautiful Soup or Scrapy? : Python [[scrape]] [[python]]
https://www.reddit.com/r/Python/comments/69wym8/when_do_you_us_beautiful_soup_or_scrapy/
why would you never use BS
The selectors system lack in flexibility, it is slow and its HTML parser is not really good for the modern world of opening a page in a browser and looking at what's there to know what to do.
[2019-03-05] TLDR: scrapy is better
[2019-04-07] DataFrame — pandas 0.24.2 documentation [[pandas]]
https://pandas.pydata.org/pandas-docs/stable/reference/frame.html
[2019-04-07] Comparison with SQL — pandas 0.24.2 documentation [[pandas]]
[2019-02-14] There's now a dead simple way to slap a web interface on a command line script : Python (click library) [[tui]] [[web]]
https://www.reddit.com/r/Python/comments/akgctg/theres_now_a_dead_simple_way_to_slap_a_web/
[2020-05-26] multiprocess.Pool + submitasync work properly with timeouts… unlike concurrent.futures? [[python]]
[2020-03-08] dataset: right, so synccolumn is taking quite a bit of time… I suppose because of column detection stuff [[sqlite]] [[python]]
gotcha with yield [[yield]] [[python]]
def wrapped(path: Path):
try:
it = ex(path)
# ugh. keeping yeild in the try section is not ideal, bt
yield from it
except Exception as e:
breakpoint()
[2019-07-23] date index [[pandas]] [[python]] [[data]]
I guess it's somewhat useful to have multiple stages
raw providers emit dataframe without any index in case of reporting dateless errors (if that makes sense)
then consumer can filter out errors and present them and then choose their own index and aggregateion
[2019-07-23] Which one is better: Bokeh or Plotly? - Quora [[viz]] [[python]]
https://www.quora.com/Which-one-is-better-Bokeh-or-Plotly
Compare Bokeh with Plotly
1. Easy to install. The process is very similar to Plotly.
2. Bokeh plot is not as interactive as Plotly.
3. Limitation on drawing string value on plot. It looks like only the bar chart can take the string values. Date time string has to convert to DateTime type first in order to be on non-bar plots such as scatter, line, etc.
4. It is not easy to overlay different type of plots on one figure.
5. Less examples online.
6. Less integrated with Panda than Plotly.
[2019-07-23] Plotly vs Bokeh vs … : Python [[viz]] [[python]]
https://www.reddit.com/r/Python/comments/5nwk9r/plotly_vs_bokeh_vs/
The last advantage I found that plotly has over bokeh is that almost everything in plotly is a dict. This is really useful because I've found certain plotly functions are really slow for some reason or can't be called when you use the multiprocessing module because of pickling issues. Not a problem, in the end they generate dicts under the hood, you can do the same yourself and still pass those dicts to plotly. Also calling help() on plotly objects tells you what keys and values you need to add to your dict.
[2019-05-18] unwrap vs assert: assert is a statement, so can't do in one line [[python]]
[2018-11-10] imp.loadsource for loading python module from file [[python]]
[2018-06-21] Ok, to prevent pollution just assert everything in _all isinstance [[python]]
[2018-08-26] dill seems to be superior to pickle
e.g. unpicling requires exactly same modules etc? might be hard if you want to unpickle elsewhere
https://stackoverflow.com/a/25244948/706389
[2019-02-12] Choosing a Python Visualization Tool - Practical Business Python [[python]] [[viz]]
https://pbpython.com/python-vis-flowchart.html
[2019-02-12] Quickstart — Bokeh 1.0.4 documentation [[viz]]
https://bokeh.pydata.org/en/latest/docs/user_guide/quickstart.html#userguide-quickstart
[2019-04-06] ok, so apparently bokeh is more akin to plotly?
[2019-02-12] python - how to set readable xticks in seaborn's facetgrid? - Stack Overflow [[plotting]] [[seaborn]]
https://stackoverflow.com/questions/43727278/how-to-set-readable-xticks-in-seaborns-facetgrid
The seaborn.pointplot is not the right tool for this plot.
plotting a lot of data via seaborn
[2019-12-12] #45 Control color of each marker | seaborn – The Python Graph Gallery [[seaborn]]
https://python-graph-gallery.com/45-control-color-of-each-marker-seaborn/
scatter_kws={'facecolors':df['color']}
[2020-01-17] python - Format x-axis on chart created with pandas plot method - Stack Overflow [[drill]] [[pandas]]
https://stackoverflow.com/questions/44496383/format-x-axis-on-chart-created-with-pandas-plot-method
ax = df.plot(kind='bar')
x_labels = df.index.strftime('%b')
ax.set_xticklabels(x_labels)
Comment:
pandas date ticks
[2020-04-18] screw hatch. it's got some weird defaults and doesn't provide much value [[pip]]
i.e. default got username set to "", which gets in the way of using token
[2020-02-16] python - Argparse: Way to include default values in '–help'? - Stack Overflow
https://stackoverflow.com/questions/12151306/argparse-way-to-include-default-values-in-help
parser = argparse.ArgumentParser(
# ... other options ...
formatter_class=argparse.ArgumentDefaultsHelpFormatter)
[2019-07-20] I created a GitHub repository explaining the complete process of gathering data, transforming it, getting insights and making plots using pandas, NumPy, Matplotlib and Seaborn. /r/Python [[python]] [[viz]]
[2019-07-24]I know all of that but maybe good for newbies
[2020-02-18] google/pytype: A static type analyzer for Python code
https://github.com/google/pytype
[2020-01-03] Comparing Python Command-Line Parsing Libraries – Argparse, Docopt, and Click | Hacker News [[python]]
https://news.ycombinator.com/item?id=10185290
I had a simpler case that I couldn't figure out using docopt. I was trying to add in tls flags into docker-compose to match docker. I could not get a combination working where you can just specify --tls to mean tls is true while still accepting --tls=true|false|0|1.
[2020-10-24] sdispater/pendulum: Python datetimes made easy [[python]] [[datetime]]
Why not Arrow?
Arrow is the most popular datetime library for Python right now, however its behavior and API can be erratic and unpredictable.
[2020-09-05] fastcore: An Underrated Python Library | fastpages [[python]]
[2021-01-05] On Repl-Driven Programming | Hacker News [[repl]]
Another way is ipython %edit magic command and $EDITOR set to vim and using %autoreload
[2020-11-28] ast — Abstract Syntax Trees — Python 3.9.1rc1 documentation
ast.literal_eval
[2019-12-27] Why Python is my Favorite Language • Buttondown
https://buttondown.email/hillelwayne/archive/why-python-is-my-favorite-language/
What I need is an “X for Y”, but better. Something like To Ruby from Python or Go for Python Programmers only cover the core. They don’t cover the peripheral libraries or the lagangue ecosystem. Hyperpolyglot is better, but doesn’t talk much about the ecosystem. It also doesn’t compare across language families, which could be very helpful here.
[2020-12-17] wrapt · PyPI
Module for decorators, wrappers and monkey patching.
[2020-12-13] pydot/pydot: Python interface to Graphviz's Dot language [[viz]]
[2020-12-05] NBSafety Fearless interactivity for Jupyter notebooks
[2020-12-29] Top 10 Python libraries of 2020 you should know about | Tryolabs Blog
To power its capabilities, Typer internally stands on top of Click, which is very well-known and battle-tested. This means that it can leverage all its benefits, community and plugins, while starting simple with less boilerplate code and growing more complex as you need.
[2020-09-03] Overviews — PyViz 0.0.1 documentation
[2020-12-05] fastai/nbdev: Create delightful python projects using Jupyter Notebooks
Features of Nbdev
- Automatically generate docs from Jupyter notebooks. These docs are searchable and automatically hyperlinked to appropriate documentation pages by introspecting keywords you surround in backticks.
- Utilities to automate the publishing of pypi and conda packages including version number management.
- A robust, two-way sync between notebooks and source code, which allow you to use your IDE for code navigation or quick edits if desired.
- Fine-grained control on hiding/showing cells: you can choose to hide entire cells, just the output, or just the input. Furthermore, you can embed cells in collapsible elements that are open or closed by default.
- Ability to write tests directly in notebooks without having to learn special APIs. These tests get executed in parallel with a single CLI command. You can even define certain groups of tests such that you don't have to always run long-running tests.
- Tools for merge/conflict resolution with notebooks in a human readable format.
- Continuous integration (CI) comes setup for you with GitHub Actions
[2020-12-07] Running Python code in a subprocess with a time limit | Simon Willison’s TILs
Running Python code in a subprocess with a time limit
[2020-12-07] tiangolo/typer: Typer, build great CLIs. Easy to code. Based on Python type hints.
Typer, build great CLIs. Easy to code. Based on Python type hints.
[2020-11-30] Allow to customize location of .eggs directory · Issue #1854 · pypa/setuptools
My code lives in a read-only partition mounted into a Docker container and therefore the build fails:
[2020-10-20] PyInstrument – A statistical Python profile that focuses on the slow parts | Hacker News
[2020-11-25] python - Extract traceback info from an exception object - Stack Overflow [[errors]]
There's a very good reason the traceback is not stored in the exception; because the traceback holds references to its stack's locals, this would result in a circular reference and (temporary) memory leak until the circular GC kicks in. (This is why you should never store the traceback in a local variable.)
frustrating: so much duplication [[pip]]
there is github topics, github description, readme, pypi readem, readthedocs readme, classifiers etc
[2020-05-28] Hypermodern Python | Lobsters
Agree. I now have a sudden urge to write a guide how to start from very simple (i.e. system interpreter, no packaging, minimal verification) and how to progress further on. And how to decide what tools do you even need to consider and at which stage.
In hindsight as a somewhat experienced Python programmer I can see how each of these tools can be helpful – but if I was a beginner I would be completely overwhelmed.
[2020-05-30] The Hard Part of Learning a Language • Hillel Wayne [[toblog]] [[python]]
I've gained massive amounts of random Python knowledge over the past month of actively working on my projects [[toblog]] [[python]]
but I have no idea how to communicate it.
some problems are just obscure to write a proper blog post or something
self-answering stackoverflow questions??
[2020-01-04] python - How can I make setuptools install a package that's not on PyPI? - Stack Overflow
https://stackoverflow.com/questions/3472430/how-can-i-make-setuptools-install-a-package-thats-not-on-pypi
why python sucks: dependencies
[2020-04-17] pypa/gh-action-pypi-publish: GitHub Action for publishing pre-built distribution packages to PyPI (from `dist/` dir) [[githubci]]
- name: Publish a Python distribution to PyPI
uses: pypa/gh-action-pypi-publish@master
with:
user: __token__
password: ${{ secrets.pypi_password }}
so much indirection!!
[2020-04-18] Publishing package distribution releases using GitHub Actions CI/CD workflows — Python Packaging User Guide [[githubci]]
[2020-12-22] uva-graphics/autoimp: Automatic Python imports
The autoimp module imports all available Python modules automatically at the Python interactive prompt, similarly to Matlab:
[2020-01-25] My Python setup for 2020 | Noam Elfanbaum https://noamelf.com/posts/my-python-setup-for-2020/
pyenv install 3.8.0
pyenv shell 3.8.0
https://noamelf.com/posts/my-python-setup-for-2020/
[2019-09-17] Vendoring Python dependencies with pip - Underdog.io Engineering Team - Medium https://medium.com/underdog-io-engineering/vendoring-python-dependencies-with-pip-b9eb6078b9c0 [[python]]
[2020-02-04] PyPy - Performance https://pypy.org/performance.html#profiler
PyPy 2.6 introduced vmprof, a very-low-overhead statistical profiler. The standard, non-statistical cProfile is also supported, and can be enabled without turning off the JIT. We do recommend vmprof anyway because turning on cProfile can distort the result (sometimes massively, though hopefully this should not be too common).
[2020-05-03] PEP 612 – Parameter Specification Variables | Python.org
[2020-01-06] Please Fix Your Decorators · Homepage of Hynek Schlawack https://hynek.me/articles/decorators/
If your Python decorator unintentionally changes the signatures of my callables or doesn’t work with class methods, it’s broken and should be fixed. Sadly most decorators are broken because the web is full of bad advice.
[2019-09-23] bast/somepackage: Show how to structure a Python project. https://github.com/bast/somepackage
[2019-11-17] holtzy/The-Python-Graph-Gallery: A website displaying hundreds of charts made with Python https://github.com/holtzy/The-Python-Graph-Gallery [[viz]]
[2019-12-05] Debugging Jupyter notebooks - David Hamann https://davidhamann.de/2017/04/22/debugging-jupyter-notebooks/
There’s also ipdb but importing and calling it directly only works in the terminal, not in notebooks (see this issue).
[2019-12-13] python-poetry/poetry: Python dependency management and packaging made easy. https://github.com/python-poetry/poetry
In other words, poetry uses pyproject.toml to replace setup.py, requirements.txt, setup.cfg, MANIFEST.in and the newly added Pipfile.
[2020-12-13] Do You Have Any Offline Programming Techniques or Tools? | Lobsters
import pdb; pdb.pm() starts a post-mortem debugger. When you get an error in an interactive session (such as a Jupyter notebook), this will jump to the scene of the error, let you inspect local variables, and let you walk up and down the stack.
[2020-02-15] pschanely/CrossHair: A static analysis tool for Python that blurs the line between testing and type systems. https://github.com/pschanely/CrossHair
[2020-04-15] egg-info in local directory makes pip think package is installed · Issue #6558 · pypa/pip
egg-info in local directory makes pip think package is installed
[2020-04-15] I hate easy-install.pth · Issue #929 · fonttools/fonttools
I hate easy-install.pth
shit. I guess this explains why it was finding mypkgs…
[2020-05-16] macropy: syntactic macros for Python | Lobsters
acropy is excellent when one wants to use syntactic macros. One problem I had was that, for my scripts, I cannot directly use macropy and other syntax modifiers since they rely on the import hooks, which means that you can not use them directly on the script file. You have to import them separately, which makes their use cumbersome.
This was my project to work around this issue. It works, but is very hacky, and requires adding a new codec to the Python installation.
[2020-08-22] Installation — HoloViews 1.13.3 documentation
HoloViews is an open-source Python library designed to make data analysis and visualization seamless and simple. With HoloViews, you can usually express what you want to do in very few lines of code, letting you focus on what you are trying to explore and convey, not on the process of plotting.
[2021-02-14] ok, naming test modules the same as originals doesn't end up well… [[python]]
e.g. when I was writing pytest tests/core/test_pandas.py vs pytest tests/core/pandas.py
[2021-02-09] python - Using property() on classmethods - Stack Overflow
Python 3.9 2020 UPDATE
You can just use them together (taken from the 3.9 docs):
class G:
@classmethod
@property
def __doc__(cls):
return f'A doc for {cls.__name__!r}'
[2021-02-10] Web Scraping 101 with Python | Hacker News
import pandas as pd
dfs = pd.read_html(url)
wow. can scrape off table elements?
–system-site-packages? [[pipx]]
strptime idea – cache time string and somehow speed up? [[python]]
could be like re.Pattern, or with automatic cache?
hmm, maybe possible to self-pack minimal package in setup.py? could work… [[python]]
[2021-02-23] Tiendil/smart-imports: smart imports for Python [[python]]
[2021-02-21] djrobstep/logx: best practice, zero config python logging [[python]] [[logging]]
reasonable list (aka why python logging sucks by default)
[2021-02-23] textwrap — Text wrapping and filling — Python 3.8.5 documentation
[2020-04-09] thebjorn/pydeps: Python Module Dependency graphs https://github.com/thebjorn/pydeps [[project]] [[python]]
[2020-05-15] Hello flake8 • Dimitri Merejkowsky [[pylint]]
Itamar Turner-Trauring 2, in the comment section on dev.to gave an interesting example:
handling accidental variable capture in closures
[2020-07-06] Brython – A Python 3 implementation for client-side web programming | Hacker News [[python]] [[js]]
[2021-03-16] leeoniya/uPlot: 📈 A small, fast chart for time series, lines, areas, ohlc & bars [[python]] [[dataviz]]
focus on performance?
[2021-04-02] cleanup; remove unused imports by seanbreckenridge · Pull Request 151 · karlicoss/HPI [[flake8]]
find ./my | entr flake8 --ignore=E402,E501,E741,W503,E266,E302,E305,E203,E261,E252,E251,E221,W291,E225,E303,E702,E202,F841,E731,E306,E127 E722,E231 my | grep -v __NOT_HPI_MODULE__
[2021-03-23] Iterables vs. Iterators vs. Generators » nvie.com [[python]]
good tutorial
[2021-03-07] hhatto/autopep8: A tool that automatically formats Python code to conform to the PEP 8 style guide. [[python]]
Seems like a more sensible alternative to black
[2021-03-20] python - Suspend on exception in pdb - Stack Overflow [[python]] [[debug]]
You're looking for postmortem mode:
try:
code_that_may_raise_exception()
except Exception:
import pdb; pdb.post_mortem()
This will break on exception and drop you into a debugger right where it is being raised from
nice! a bit magical, but works exactly as described
tips about putting test next to code [[python]] [[toblog]]
- no overhead about creating new files
- no need to worry about pythonpaths etc
how to:
- pytest imports in the function itself
- defensive decorator?
- fixtures still work! like tmppath
TODO mention doctests? pros/cons. how to set up common env for doctests?
[2021-04-04] How to make an unaware datetime timezone aware in python - Stack Overflow [[tz]]
>> unaware.replace(tzinfo=ZoneInfo('localtime'))
datetime.datetime(2020, 10, 31, 12, 0, tzinfo=zoneinfo.ZoneInfo(key='localtime'))
>>> str(_)
'2020-10-31 12:00:00+01:00'
pip install backports.zoneinfo
[2021-04-06] python - How do I parse an ISO 8601-formatted date? - Stack Overflow
Although strptime can parse the 'Z' character to UTC, fromisoformat is faster by ~ x40 (see also: A faster strptime):
[2021-03-30] setuptools - python: simple example for a python egg with a one-file source file? - Stack Overflow [[pip]]
You can use the py_modules argument instead of the packages argument to list single file modules.
See https://docs.python.org/3/distutils/setupscript.html#listing-individual-modules
[2021-04-04] Utilities — Click Documentation (7.x) [[cli]] [[python]]
progress bars, nice
[2021-04-16] pythonql/pythonql: A Query Language extension for Python: Query files, objects, SQL and NoSQL databases with a built-in query language [[python]]
PythonQL is implemented as a special encoding in a normal python script. When this encoding is specified, the pythonql preprocessor is run, which converts the pythonql syntax to pure python.
So you should have a line in the beginning of your script:
#coding: pythonql
result = [ select y for x in [1,2,3] let y = x**2 ]
whoa
[2021-05-01] PythonPackagingTerminology - Python Wiki [[pip]]
*.egg-link files that contain the name of a built or development egg, to support symbolic linking on platforms that do not have native symbolic links.
Python is a scripting programming language.
= Packaging Packaging in Python is a pain for me. From now on, I will try to collect some articles describing people failing to publish a Python package.
=> https://warmedal.se/~bjorn/posts/2021-09-12-python-packaging-woes.html | Python Packaging Woes
I've been trying to figure out python3 packaging, but have only had some success. As always I guess it comes down to the combination of me not having the prerequisite knowledge to understand some docs, and me wanting to do something that isn't really supported.
bouncepaw: I tell you what. On all the machines I've tried, never have I succeeded to install a Python package and get it running on the first attempt. Never. Be it GNU+Linux, be it Mac, whatever. Never happened. Always, there are problems that require some shamanic actions.
chekoopa: "You just don't know how to cook 'em". No problems with pip, except of some exotic C++-FFI libs requiring on-site compilation. Even more, after switching to NixOS the only reason Python ecosystem could fail for me is a rare library or packaging bug. Even more, with Nix it becomes dead simple to package a Python app. No virtualenv's, no requirements.txt, ever.
bouncepaw: Yeah, I have no idea how to cook em. But I do expect that installing a random package will succeed with no prior configuration. That's what package managers are what, right? NixOS saves the day!
= Multithreading.
chekoopa: GIL is a dirty workaround and sucks. The only reasonable way to do parallel jobs with Python is asyncio, which is still a single thread with sugared control passing.
Python
Python is one of the most popular programming languages in the world. It is known for its simple syntax.
Related entries:
- [[crowdmark-labeler]]
- [[econ-ipsum]]
-
Couldn't parse #push. See source for content.
-
#push [[python]] libraries
- most popular: [[feedparser]]
- new contender: [[atoma]]
- public document at doc.anagora.org/python
- video call at meet.jit.si/python
2021 02 02
2021 06 14
2021 07 05
2021 12 14
2022 05 04
2022 08 21
2022 11 15
agora feeds
agora install
anagora
atoma
atproto
axelrod s tournament
cachew
celeste summit
click
crowdmark labeler
dej
econ ipsum
elisp
elisp sucks
emacs
error handling
exports
feedparser
fire
flask
hashtags
hpi
infra
itertools
jacobsayles
lisp
literate
lxml
marko
maubot
misc
moa party
oilshell
orgparse
poetry
programming misc
promnesia
python_as_shell
qutebrowser
remailable
st
takahe
tech_meet_2022 07 04
think
timeline
toot_expirator
toot_expirator_source
tostudy
typing
uwsgi caching
vr
bokeh
cachew
ci
cli
concurrency
crowdmark labeler
data
dataviz
datetime
debug
decorator
drill
econ ipsum
errors
flake8
git
githubci
gui
habit
hpi
ipdb
ipython
js
json
jupyter
kython
lisp
logging
macro
mypy
pandas
parsing
performance
pip
pipx
plotting
plt
project
promnesia
pylint
pypi
pypy
pytest
python
repl
sage
scrape
scrapy
seaborn
security
selenium
sqlite
sympy
testing
timezone
toblog
towatch
tox
tui
tz
vim
viz
web
webext
yield